PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G0935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GRAS
Protein Properties Length: 643aa    MW: 71249.7 Da    PI: 5.9237
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G0935genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS329.46.7e-1012856422374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +++L+++Ae +++gd  laq +Larl+++ sp g+p+ R+a+yf+eAL+  l        ++ ++s+  ++n++ ++aa+k fse+sP+++f ++t+N
  Gh_D12G0935 285 IDQLIQAAELIETGDPVLAQGILARLNHQLSPVGKPFIRAAFYFKEALQLLLRF------NTTNTSTLYTTNMIFKIAAYKSFSEISPTVQFMNFTCN 376
                  689**********************************************98886......788888888899************************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL..r 195
                  qaIle +eg++rvHiiDfdi++G+QW++L+q+L  R++g+p ++iT+++ p+s ++ el  t e+L++fA+e+++ f+++++  ++l++ +  +L  +
  Gh_D12G0935 377 QAILEVFEGCNRVHIIDFDIGYGGQWASLMQELVLRNGGAPCMKITAFACPTSYDEFELGFTIENLKHFANEINMGFDIKIVSLEALNSCSWYSLplH 474
                  *********************************************************************************98889999988887336 PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  + ++E++aVnl +  ++ +      +s+ + +L++vk+lsPk+vv +++ +d+++ +F +++++al+ ys l++sl+a    + ++  k+Er++l+++
  Gh_D12G0935 475 FGENETIAVNLPIGSFSNY------PSTLPLILRFVKQLSPKIVVSSDRGCDRTDVPFPHHIIHALQSYSGLLESLDAV-NMNLDALEKIERFFLQPS 565
                  777**********888877......444567*********************************************766.45669999********** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  i+++v  ++++     e+   Wr+ + ++GF+p+++s+++++qa++l+++++ +g++ve+++ +lvl+W++r+L+++SaWr
  Gh_D12G0935 566 IEKIVLGRHRS----LERRPPWRSLFIQSGFSPLTFSNFTESQAECLVQRTPIRGFHVEKRQLALVLCWQRRELIATSAWR 642
                  ******99998....88889************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.657258622IPR005202Transcription factor GRAS
PfamPF035142.3E-98285642IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MNAMPLSFEE FQGKGALDFA SSTSSYSNSS LLLQHQQQKK WQNNKESCCY VGFDPTSTRS  60
PSPPTSSSTL SSSFDGGSGG ASTDSSGVAE TATVSKGKSQ SFDTGTGKCG LSMEDWENDQ  120
SILRLIMGDV DDPSLGLNKI LQPPSGSCGG GGSSKNMEFN AGFGMVDHSF GFDSITSSVS  180
LMNNDMVSCL NPVFDQNQAE FTQNPVMLFP SYAAEMQEHN LLSPPPPNRF NSGTSGPNYK  240
VPKVQFSSSG PEHYLRRQQL LQQRPTTPKI VTDEMANQQL QQAIIDQLIQ AAELIETGDP  300
VLAQGILARL NHQLSPVGKP FIRAAFYFKE ALQLLLRFNT TNTSTLYTTN MIFKIAAYKS  360
FSEISPTVQF MNFTCNQAIL EVFEGCNRVH IIDFDIGYGG QWASLMQELV LRNGGAPCMK  420
ITAFACPTSY DEFELGFTIE NLKHFANEIN MGFDIKIVSL EALNSCSWYS LPLHFGENET  480
IAVNLPIGSF SNYPSTLPLI LRFVKQLSPK IVVSSDRGCD RTDVPFPHHI IHALQSYSGL  540
LESLDAVNMN LDALEKIERF FLQPSIEKIV LGRHRSLERR PPWRSLFIQS GFSPLTFSNF  600
TESQAECLVQ RTPIRGFHVE KRQLALVLCW QRRELIATSA WRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-312846424375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.55710.0boll| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3951681e-125GQ395168.1 Gossypium hirsutum cultivar Delta Opal clone MONCS2191 SSR marker DPL0796 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437504.10.0PREDICTED: scarecrow-like protein 6
SwissprotO813161e-170SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A0D2SYJ30.0A0A0D2SYJ3_G
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-163GRAS family protein